Sequence for MER1047997

>MER1047997 - family S51 unassigned peptidases [S51.UPW] peptidase unit: 62-202 ( active site residue(s): 132,167,202  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MPAERPTILATSMGFHRARDPWQPSPVFRLAFDLAGGPSRPRLCFVTTGTGDRQTSIDAF       60
61       YAAFDGTGVMTSHLALFDKPNMPNVTEHLHEQDVIWVDRGSVVNLLAVWRAHGIDEILRD      120
121      CWTRGVVMGGESAGSLCWFTGGTTDSFGSMRAFADGLSLLPFSNAVHYSDRREHFRSCVA      180
181      AGELPEGYTTEAGAGLHFAGTECVGAFADRKSAAAYRVVRRSDGTVTEDQLEVRRLER        238