Sequence for MER1026553

>MER1026553 - family S15 non-peptidase homologues [S15.UNW] peptidase unit: 38-154 (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MATDESIDRGAATAAVQRRDVEFLSDGVPCAAWLYTTPGAPGPRPIVIMGHGLGAVREMR       60
61       LAAFAERFAANGWSVLVFDYRHLGASGGRPRQLLDIGRQLADWRAAVAFARTLPEVDVDR      120
121      IALWGTSFGGGHVLQVGSGNPQVAAIVAQCPFTDGPASLISRLRTGPLSAVALMAVGILD      180
181      TARSWLGSKPILVPMAGTSWMPAFVASPDAIAGASALLPPGTRLSRRSSALLRRLPSVRA      240
241      RLSENIELTIADDREPVTKVGRDSIWGVFRGPGNDFDAANALAARLVLRLPLYRPGRAMA      300
301      RSGVPTLLCVCDNDAAAPAETTKRRARGLAHVRVKTYPCDHFDIYLGTYFEDAVRDQIDF      360
361      LAEQFADTVPAAT                                                     373