Sequence for MER1021701

>MER1021701 - family S15 unassigned peptidases [S15.UPW] peptidase unit: 58-272 ( active site residue(s): 143,271  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MNSATRVSRRRRVAAVLAAVAVAATACATAEAPASNEPVRQWGYLTLPTGERMRYSVVLP       60
61       EASGQFPVLVEYDGYGAGTEPSIGMPWVREGYAVVGLNVPGTGCSTGDNHMFGAEIGAAG      120
121      AFAVEWAAQQPWSTGRVGMIGYSYSGYNQLWTAAERPRGLTAITPSKNVGDPYRDVAYPG      180
181      GIRNSGFPTAWWGEFPEIWRSAAQRAAELDGDTDCAATVADNIAKAQRPEFDFGRRITET      240
241      TEHEGFYVDKSARSRTDRIDVPVLATQSWQDEQVGTRMGYVEETVRPDLLWTVSSNGDHH      300
301      TDLTSADIRELMRRFLARYVKDEDNGFEREPRVRVLQEMQVAGSGEEQTTTPTAVAEFGL      360
361      PVPVTPLRLWFGPDDTLTQAPPAPDTPGAEYRYPVSGSVVNDAPAEGWSPDTAPDGRRAF      420
421      TTAALPQALSFLGAGSVDLWLSSTAPDTDVQVTLSEVRPDGKEMFVQRGWLRASERRLDP      480
481      ALSTELRPWGDFGPDAAEPLTPGEPALLRVELPKFAHTFRPGSSIRITIDAPAQTGFWEF      540
541      DRITTEAVNTVLLDAAHPSSVVLGYTPYPHAPALPSCATTLRQPCRDNTTPVPPGEGPRP      600
601      PA                                                                602