Sequence for MER0912792

>MER0912792 - family M79 unassigned peptidases [M79.UPW] peptidase unit: 104-201 (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MSVRRSGRHAKAAAAVLLPLAWNNRLLPALGLGIRGRTAAHLTFALGYARALGAHPNWLS       60
61       PRGFRAGLLISAVVAAGSAAALTCPRTRAALAAAPDRTPEVRTAEWITVHIPLGTALPEE      120
121      LIFRATLDPLLTTALGPRPALLIGPLTFGLWHIHSARAAGDPILPTIAATTAAGVVFSSL      180
181      YRRTAGAVAPTLVHLTLNTAGAVITTSARKRARRGPPEGIPGRRP                     225