Sequence for MER0911387

>MER0911387 - family M79 unassigned peptidases [M79.UPW] peptidase unit: 62-227 (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MAATERGRPLHAYIDVAVVVVVLACTNLIAHFTTAWANIVAVPVAAGILLALVRRRGLGW       60
61       AELGLSPRHWRRGSVYALAAVGVVLAAVAIGALLPVTRPFFLADRYATVSGALIASMIVI      120
121      PLQTVIPEELAFRGVLHGTLDRAWGARGVFAAGSLLFGLWHVASSFGLTSGNRGLSGMLP      180
181      GGPLGQVVGILLAVLATAAAGTVFTWLRRRSGSLLAPIALHWSVNGAGALAAAIVWHTTL      240
241      A                                                                 241