Sequence for MER0907796

>MER0907796 - subfamily M67A unassigned peptidases [M67.UPA] peptidase unit: 4-97 ( active site residue(s): 23 metal ligand(s): 79,81,92 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MLVIKSDLVAAMVAHARADHPDEACGVIAGPEGSDRPERFIAMTNAERSPTFYRFDSGEQ       60
61       LKVWREMDAADEEPVVIYHSHTATEAYPSRTDISYASEPNAHYVLISTRDPEQHELRSYR      120
121      ILDGVVTEEPVRVVDDYDTDDHDTVTPGA                                     149