Sequence for MER0888465

>MER0888465 - subfamily M48B unassigned peptidases [M48.UPB] peptidase unit: 146-276 ( active site residue(s): 182 metal ligand(s): 181,185,222 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006619) 
1        MIVALGAAWAAALLSLASPAILQRITPSMTPRTAVACWLISLGSAVVLAGVAVTAALWPG       60
61       HAPGVGVAEAAMLCLTRVVHSVPHWLADPLTVAALAGVVGLSYRVALSARRHTRAGARVR      120
121      AYHRDVVSVVARRGDEDMPVMWLDHPKPMAYSVDGRPGMVVATEGLARKLNDGQRQAVLA      180
181      HELAHLRGGHHRLIRGCEVLAAAMPWIPLFADAPKAVAALAEFAADDCAAAATSPATIRS      240
241      ALCAVAATTGTEPASTLSLAGQVLQQRLQRLESSNPPRRSSRWVLMGLSPIVAAVAAPAG      300
301      LLTCAVVACVVMS                                                     313