Sequence for MER0647085

>MER0647085 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 55-230 ( active site residue(s): 186 metal ligand(s): 185,189,195 ) (Manacus vitellinus) (Source: ProtID XP_008932760) 
1        MSALQSGKAVQSAVATMQQFYGIPVTGVLDETTIEWMKKPRCGVPDHPHLRHSRRKKRYA       60
61       LTGQKWRQKHITYSVHNYTPKVGEIDTRRAIRQAFDVWQRVTPLTFEEVPYHEIKNDRKE      120
121      ADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNSNHDGNDLF      180
181      LVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPIEPLEPTR      240
241      PLPTLPVRRIHSTSERKHERQPRPPSPPLGDRPALPGSKPNICDGNFNTVALFRGEMFVF      300
301      KDRWFWRLRNNRVQEGYPMQIEQFWKGLPAKIDAAYERSDGKFVFFKGDKYWVFKEVTAE      360
361      PGYPHSLVELGNCLPREGIDTALRWEPVGKTYFFKGDRYWRYNEDKRATDPGYPKPITVW      420
421      RGVPQAPQGAFISKEGFYTYFYKGKEYWKFDNQRLSVEPGYPRSILKDWMGCNQKDVERS      480
481      KDRRLPHDDVDIMVTINDVPSTVNAIAVVIPCILSLCILVLVYTIFQFKNKEVQQNVVYY      540
541      KRPVQEWV                                                          548