Sequence for MER0485189

>MER0485189 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 39-407,214-317 ( active site residue(s): 170 metal ligand(s): 169,173,179 ) (Trichechus manatus) (Source: ProtID XP_004370463) 
1        MQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIH       60
61       NYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSS      120
121      PFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHS      180
181      NDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSER      240
241      KHERQPRPPRPPLGDRPSTPGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEG      300
301      YPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPR      360
361      EGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEG      420
421      YYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQEVERRKERRLPQDDVDIMVTIN      480
481      DMPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKAGPQPVTYYKRPVQEWV               531