Sequence for MER0469715

>MER0469715 - DD-carboxypeptidase pdcA ({Myxococcus}-type) [M15.002] peptidase unit: 130-226 ( active site residue(s): 221 metal ligand(s): 188,195,224 ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MSRHGRVELSDTPIRVGVSLSECRASGGVIHRDLWICGLSLTVHCPPPARRPTRMIDRPG       60
61       CRATRSAPATMIAMSRRPQVITRRTLAAVLAGPVVLTGVLATATATAAPGEQREALGSAA      120
121      GTDGLDPALAVAYTLAEQAAHAEGVPLSITSGYRTPAEQQALWEDGLATYGSPEEARRWV      180
181      LPPEESTHVSGQAVDVGPQAGAQWLERNGNRWGLCRTYANEWWHFELATIPGGSCPPLRP      240
241      DASER                                                             245