Sequence for MER0467416

>MER0467416 - subfamily M10B unassigned peptidases [M10.UPB] peptidase unit: 90-168 ( active site residue(s): 157 metal ligand(s): 156,160,166 ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MNTLAICSPKRLPDDKQIESARLAVEINPANMPYVRPIAGLVGERPVNREFISAMTTKYW       60
61       RSGGVHLGVRFLDTTDRALQDRILAHMNAWSPGANIGFHRSTAPDAEIRIARTPGDGYWS      120
121      YLGTDVLQIPADEPTMNLDSFGLDTDEREYTRVVRHETGHTLGFPHEHLRRDVVHRIDPA      180
181      KAIRYFRDRVGWSEATTRAQVLTPLEEVALITTPTDTQSIMCYQLPGSIMRDGRPVPGGL      240
241      DINDRDRGFVHVLYPTAVATTPIQALAGVH                                    270