Sequence for MER0463368

>MER0463368 - subfamily C82A unassigned peptidases [C82.UPA] peptidase unit: 241-372 ( active site residue(s): 331,349  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MMSVGPRRRRVLRALSLPAVLLAVLALALTACTSSNGGGSAVAIDRNPITELIKPKLLSP       60
61       VKDGDKGVSPAAPMTFQVEDGRFTDVTLVNQQGKAVQGKLAADGRTWETTEVLGYGKTYR      120
121      LTAEAIGLGGVNSTTLSFTTSSPDNQTKPYLIPGEGEVVGIGQPVAIQFDENIPDRRAAQ      180
181      DVIKITTNPPVEGAFYWLNNREVRWRPEHFWAPGTRVDIEVNVYGKDLGNGLYGQENITS      240
241      HFIVGDAVIFTADDNTKQVVVEQNGQVIRTMPTSMGKDSTPTDNGIYIVADKHEKIIMDS      300
301      STYGVAVNSPDGYRTPVDFATRISYSGIFFHSAPWSVGAQGNSNTSHGCLNLSPANAQWV      360
361      YNFAKRGDITIIKNTVGGTLSGTDGLGDWNIPWSVWKAGNADIG                      404