Sequence for MER0461829

>MER0461829 - subfamily C82A unassigned peptidases [C82.UPA] peptidase unit: 172-308 ( active site residue(s): 267,285  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MDEVGGRHYTPMKCLARCVRAGDGMDEKPMHAASNDRPMPTHDRLTRRLRRGVLLSAAIA       60
61       AAGAVIVAPAQAEPLFPGLDSGSASAVTEPTPQANFAPPNINIADGETVGVAQPIIITFK      120
121      EPIEDRATAEKAIKITSSNEAPGHFYWWSDKQVRWRPNDFWPANTDVRVEAGGTTSSFRI      180
181      GDAQITTADDATKTITITRNGEVVKTMPTSLGKPGHETPNGTYIVGERHRQMVMDSSTYG      240
241      VPIDAPEGYKLDVEYATRLSNSGIFLHAAPWSVGQQGVANVSHGCLNVSTEDARWFFENA      300
301      QKGDPVIVQNTAGGTLNARDGLGDWN                                        326