Sequence for MER0458606

>MER0458606 - glutamate synthase (NADPH) large chain [C44.003] peptidase unit: 25-410 ( active site residue(s): 25  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MTQLPGHRSPGPIGLYDPANEHDACGVAFVVDMHGRRSRDIVDKAITALLNLEHRGAAGA       60
61       EPNSGDGAGILIQIPDRFFRAIVDFELPPEGSYASGIAFLPQARREAARAAYGVEKIVKE      120
121      EGLEVLGWREVPIDDSSLGALSRDAMPTFRQIFIASPRTGAEQLSGMDLERRAYVIRKRV      180
181      EHELGTQGAGEGATGRETVYFPSLSGQTFVYKGMFTTPQLRAFYLDLQDDRVESALGIVH      240
241      SRFSTNTFPSWPLAHPFRRVAHNGEINTVTGNENWMRAREALLNSDVFGTDAAGKNRLEK      300
301      IFPVCTPGASDTARFDEVLELLHLGGRSLPHAVLMMIPEAWERHDSMDPQLRAFYEYHSM      360
361      LMEPWDGPASVCFTDGTVVGAVLDRNGLRPSRIWVTDDGLVVMASEVGVLDIDPAKVVRK      420
421      ARLQPGRMFLVDTSQGRIVDDHEIKTQLAAEHPYQQWLDEGVTRLADLPDRPHVHMSHDR      480
481      VLIRQQIFGYTTEELSLLISPMAKTGGEALGSMGTDTPIAVLSSRPRLLFDYFSQLFAQV      540
541      TNPPLDAIREEVVTSLKRNLGSEADLLHPGPESCKQIAIEQPILDNDELAKLVHINDDGS      600
601      QPDLRSVVVRGLYPVKKGGKGLRKALQAINTQVSAAIEGGARIIVLSDRESNEKLAPIPS      660
661      LLLTSSVHHHLVRERTRTKVGLIVEAGDAREVHHMAMLVGFGAGAINPYMAFETIEDMLE      720
721      RGALDLGTGDLASDYRKAVANYIKAAGKGVLKVMSKMGISTLASYNGAQLFQVIGLSQEL      780
781      VDEYFTGLRSHLDGIGLDEIADDVAARHRIAFLENRNERAHRELEVGGEYQWRREGEYHL      840
841      FNPDTVFKLQHATRTGQYSIFKEYTKLVDDQSERLASLRGLFKFKKGERAPIPIDEVEPA      900
901      SEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSGEGGEHPARFEVEENGDWRRSA      960
961      IKQVASGRFGVTAHYLTNCTDIQIKMAQGAKPGEGGQLPAHKVYPWVAEVRHSTPGVGLI     1020
1021     SPPPHHDIYSIEDLAQLIHDLKNANPQARIHVKLVAEPGVGTVAAGVSKAHADVVLISGH     1080
1081     DGGTGASPLTSLKHAGGPWELGLAETQQTLLLNGLRDRIVVQVDGQMKTGRDVMIAALLG     1140
1141     AEEYGFATAPLVVSGCVMMRVCHLDTCPVGVATQNPVLRERFTGKPEFVENFFLFIAEEV     1200
1201     RELLAQLGFRTLDEAIGRVDLLDTSKAKQHWKASKLDLSPILDDIETAFMFQDRRCTKSQ     1260
1261     DHGLDRALDQQLITEAREALERGKPVKIDTKITNVNRTVGTMLGHEVTKLYGGAGLPDDT     1320
1321     IDITFTGSAGNSFGAFVPAGITLRVQGDANDYVGKGLSGGHLVVRPAPNAPAEFVADQNI     1380
1381     IAGNVILFGATSGKAFISGVVGERFAVRNSGATAVVEGVGDHGCEYMTGGRVVILGETGR     1440
1441     NFGAGMSGGVAFVYDPNGTFAARVNPEQRDALEPLAGDDFTWLRDIIAEHRDKTGSAVAD     1500
1501     RILSDWSQQVNHFVKVMPREYKKVLLAISEAEKSGKDVDEAIMEAARG                 1548