Sequence for MER0451317

>MER0451317 - imidazoleglycerol-phosphate synthase ({Pyrococcus furiosus}) [C26.A32] peptidase unit: 39-227 ( active site residue(s): 114,213,215  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MTGREPGHSAAARKLGRVNQTSVSAPAAEPQAAPSRPTIGVLALQGDVREHLAALRACGA       60
61       EPVLVRRVGELEAVDGLVLPGGESTAISKLLQVFDLLDPLRARLRDGMPAFGSCAGMILL      120
121      ASEVLDTRPDAQHLSGIDMTVRRNAFGRQVDSFETDLDFAGLDDGPVRAVFIRAPWVERA      180
181      GDGVQVLATVPDGPSRGRIVAVRQGNVLATSFHPEVTGDLRVHRMFVDIVRAAGDRAGNV      240
241      HTPDVQPT                                                          248