Sequence for MER0402759

>MER0402759 - family U72 unassigned peptidases [U72.UPW] peptidase unit: 43-405 (Nocardia farcinica) (Source: MEROPS) 
1        MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGS       60
61       HPEYATAECDSLHQLVTHDRAGERVLEELLIDAEQRLAEEGIGGDIYLFKNNTDSAGNSY      120
121      GCHENFLVVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVS      180
181      SATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIEAGVAF      240
241      RDFALDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYYARAVEHLRNRDRDPQID      300
301      QVVDLWGRALDAVEAQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSDPKIAQLDLAYHDI      360
361      KRGRGVFDLLQRKGLAKRITEDEAVDAAVDTPPQTTRAKLRGDFITAAQEAGRDFTVDWV      420
421      HLKLNDQAQRTVLCKDPFRSVDERVDRLIASM                                  452