Sequence for MER0398061

>MER0398061 - Dop isopeptidase [U72.001] peptidase unit: 1-498 (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MQRIIGIEVEYGISTPTEPSANPILTSTQAVLAYAAAEGVPRARRTRWDYEVESPLRDAR       60
61       GFDLSRMNGPAPVIDADEVGAANMILTNGARLYVDHAHPEYSAPEVTDPLDAVIWDKAGE      120
121      RVMEAAARHASSVPGAPRLQLYKNNVDGKGASYGTHENYLMNRDTPFNQIIVGLTPFFVS      180
181      RQVICGSGRVGIGQSGDQSGFQLSQRADYIEVEVGLETTLKRGIINTRDEPHADADKYRR      240
241      LHVIIGDANLAEMSTYLKVGTTALVLDLVEAGEDLSDLQLARPVTAVHQISHDPTLRVAV      300
301      AMADGRELTGLALQRLYHERVAKFMDREGNDDPRARDILENWAMVLDLLERDPMECANLL      360
361      DWPAKLRLLEGMRSREGLNWAAPKLHLMDLQYSDVRLDKGLYNRLVARGSMKRLVSEQQV      420
421      LDAMTNPPTDTRAYFRGECLRRFGADIAAASWDSVIFDLGGDSLVRIPTLEPRRGTKSHV      480
481      GKLLDGVDSAAELVEQLTH                                               499