Sequence for MER0219130

>MER0219130 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 80-255 ( active site residue(s): 211 metal ligand(s): 210,214,220 ) (Ursus maritimus) (Source: ProtID XP_008696386) 
1        MCPSLSCVFQNWLKSYGYLLPSDSRAPVLHSGKALQSAVSTMQQFYGIPVTGVLDQTTIE       60
61       WMKKPRCGVPDHPHLSRRRRSKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAF      120
121      DVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGI      180
181      GGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNF      240
241      KLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPST      300
301      PGAKPNICDGNFNTVGLXXXEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAA      360
361      YERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFK      420
421      GERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKL      480
481      SVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINNVPGSVNAVAVVIPCILS      540
541      LCILVLVYTIFQFKNKAGPQPVTYYKRPVQEWV                                 573