Sequence for MER0213616

>MER0213616 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 53-234 ( active site residue(s): 95,203,231  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MERAIAATDWLRELRTDPAPRHHLVCFPPGGGSATAYRDLARRTGPGIAVLGVQYPGRQD       60
61       RLGEPAVPDLHTLADRIAAELLPQPVDRLALFGHSMGATVAYETARRLTEAGLPLTHLFV      120
121      SGRPAPTFVEPGRLHQGPDEGLIADLERLATDPSSVAVLRTEPGLADLVLPAVRADYQAV      180
181      ETYTPGGTDPLPCPITALVSTADPTMTPEQGDEWRDFTTGAFRRETFPGGHFYLDEQVAE      240
241      VAALISSVLAES                                                      252