Sequence for MER0211603

>MER0211603 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 3-254 ( active site residue(s): 98,225,254  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MHTVTSADGTAIAYEQIGAGTAGTVILVGGALEDRRSPKLTDLAAALAALDLTVLVYDRR       60
61       GRGDSGDTPGVYQAGHEIDDLAALVAAAGGAAALFGWSAGAVLALRAAASGRIPGLTRVV      120
121      AFEPPFVVDRTGHVPPQDAGTRLEQLLAEGKTGKAAAYYLRKVMGVPWTMVTTMRLTPYW      180
181      RTMKNLATSTAHDWAVIGPYTRGEALRPADWAELTVPVLVLAGTDSAASVKTAAAATAAA      240
241      LPLAHHRELPRLGHNQNVELIAAPTADFLTGKGAI                               275