Sequence for MER0210714

>MER0210714 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 17-252 ( active site residue(s): 94,212,238  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MPQTALFRSLALCAVLAAPALLPATAAAEPPTVVLVHGAFADPTSWDGVAADLRADGFRV       60
61       VVPDNPLRGPASDAAAIERVLDGIDGPIVLVGHSYGGAVVTNVADPDVTALVYVAAFAPQ      120
121      QGEPTQLALDPVRYPGSRLLPPALAVTARDGGLEAYVDPARFHEVFAQDVDEATAADMIA      180
181      HQRTLALTANLEPSGPASWTTTPTWYVVAAEDRVIPPASQRAMAARMGAVVSEVAASHAC      240
241      LVSAPGAVADVIAEAARR                                                258