Sequence for MER0209551

>MER0209551 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 82-323 ( active site residue(s): 170,260,318  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MIATTAVFAGLMSGLGASSATADPIIDSKALLANPTAPDGSKITKAEIKDDRNLRLYVYS       60
61       AAMDENVIIDVQRPADASVPRPTLYLLNGAGGGEDDASWVAKSDALKFLSDKNVNVIQPI      120
121      GGKWSYYTDWIKDDPTLGRNKWKTFFTEELPPLVDGALGTNGINAIAGLSTSGTTVLALP      180
181      IAKPGLYKAAAAYSGCAQTSDPVGSEFVKLTVETWGGGDTENMWGPPGSEEWVKNDPYVN      240
241      AEGLRGLELYISTGNGIPGPYDTLNGPYALPGSYGLANQILIGGVIEAGTNYCTNNLKTR      300
301      LDELGIPATYNFRPNGTHSWGYWNEEFPKSWPVLAKGLGL                          340