Sequence for MER0189827

>MER0189827 - intein-containing replicative DNA helicase precursor [N10.002] peptidase unit: 401-826,513-663 ( active site residue(s): 401,825,826  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MTTTDDRGHTDFPPEPPGEDFGRQPPHDMAAEQSVLGGMLLSKDAIADVVEVIRPGDFYR       60
61       PAHQAIYDTILDLYGRGEPADPVTVAAGLDRRGELKRIGGAPYLVTLTQTVPTAANAGYY      120
121      AEIVAEKAILRRLVEAGTRIVQYGYAGADGQDIAEVVDRAQAEVYEVTERRTTEDFLPLE      180
181      ELLQPTMDEIDSIASRGGISLGVPTGFSELDELTNGLHPGQMIIVAARPGVGKSTLGMDF      240
241      MRSCSIKHGLASVIFSLEMSRTEIVMRLLSAEAKIKLADMRSGRMSDDDWTKLARRMSEI      300
301      SEAPLFVDDSPNLTMMEIRAKARRLKQRHDLKLVVVDYLQLMTSGKKVESRQQEVSDFSR      360
361      NLKLLAKELEVPVVAISQLNRGPEQRTDKRPMVSDLRESGCLPASTRILRADTGAESTLG      420
421      ELLASGEQPLVWSLDERMRMVARPMVKVFPSGRKEVFRLRLASGREVEATGNHPFLTVDG      480
481      WIPLDRLTVGDRLATPRSVPEPVHTERMADAEVVLLAHMIGDGSCVRRQPVRYASIDEQN      540
541      LAAVSEAAEHFGVTAVRDDYAAARVTTLRLPAPYRLSRGKRNPIAAWLDELGLFGLRSHE      600
601      KFIPRRVFALPNDQVALFLRHLWATDGSVRWDSTYRQARVYYTSTSRRLIDDVAQLLLRL      660
661      GVHGRIRRVTKPGYRDAWHLTIDGADNQTVFLRDVGVHGARGDAAQVALAELEPLVRNTN      720
721      VDTVPNEVWNQVRHLLATKNITHREFSAAMGSRFCGSTMWKRSPSRSRLARVAAVLDDAD      780
781      IEMYATNDVFWDKIVEITSLGEQDVYDGTVPGTHNFVAQSISVHNSLEQDADMVILLHRP      840
841      DAFERDDPRGGEADLIVGKHRNGPTATITVAHQLHLSRFVDMARG                     885