Sequence for MER0180749

>MER0180749 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 249-348 ( active site residue(s): 264,318,330  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006362) 
1        MTAMKSPLKWAALALALLLIPVLIVAVFVDGDKDNPSFAQGKLATGTVPPEYEAWVIRAG       60
61       TMCEEISAPLIAAQIEQESNWNPNAVSPAGAQGLSQFMPYTWPSYGVDANGNGVISPFDP      120
121      PDAIMAQAKFDCTTVEQAKKDLASGRIKGDLIDIVLNAYNCGYGCVLANGGPQIVNGETE      180
181      GYAPGVKAKMAKYTQIGTGGGRVANCSQFRPGGGFGANVAAAALCWQGTPYAWGGGNIDG      240
241      PSLGIRDGGVADSHGDYGKVGFDCSGLVVYAVGQASGKTIQLPHYTTSILNDPRGREVAL      300
301      GDIQPGDIVFPGGGDPQHVGIAIGDGKMVEAPQSGDVVKISPLSNLGSGIEIRRFG          356