Sequence for MER0180593

>MER0180593 - family C26 unassigned peptidases [C26.UPW] peptidase unit: 4-198 ( active site residue(s): 87,196,198  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MSARIGVITFPGTLDDVDAVRAVRLAGAEAVNLWHADADLKQVDAVIVPGGFSYGDYLRA       60
61       GAIARFAPVMGEVVRAAEQGMPVLGICNGFQVLCEAGLLPGALTRNEGLHFICRDQWLTV      120
121      ESVSTAWTSRYEPGAQILIPLKSGEGRYQAAPAVLDELEGEGRVVFRYSGDNPNGSQRGI      180
181      AGISSANGRVVGLMPHPEHATEALTGPSDDGLGLFLSVLDTLVTA                     225