Sequence for MER0122904

>MER0122904 - subfamily C82A unassigned peptidases [C82.UPA] peptidase unit: 142-251 ( active site residue(s): 210,228  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MAAMRSVRRHLFLAIVVIALAVFGSGAAAATLVGTTTTGTIAAITPSDGRMVGIAHPVTV       60
61       EFTQPVTDRARVERAVRVEAAAPLPGTVAWTGDRTLTWTPSAPLPADSTITVRAGDVRTE      120
121      FRTNAGVYAEADLSAHTFTVSIGGQVVRTMPASMGKPGFETPTGTFPVLEKFRSIVFDSR      180
181      TIGIPLSSPEGYLIDGEYAVRLTWGGVFVHSAPWSVDSQGYANVSHGCINLSPDDAAWYY      240
241      NTVGIGDPVYIHW                                                     253