Sequence for MER0094387

>MER0094387 - PgdS peptidase [C40.005] peptidase unit: 435-532 ( active site residue(s): 196,461,515 metal ligand(s): 111,115,198 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MVAVSARGVLWFALGTVVGLIALVLVVVLPSVEDPCEGSSLLGGGPSALPPLGGYPAGDP       60
61       RAADPSPAQANPILTATPSLAAGAGPIRRTLPMAVGTFTISDVFGSRGGGHKGVDMAAAD      120
121      GTPIFSVSDGRVVAAGPASGFGNWIVVDSVDVNGRSYSAVYGHMWDHGVLVRAGDTVRAG      180
181      QQIGAVGSAGESSGPHLHFEIVPGGRFTGGRQIDPMPWLDGAPTPDLGGAQWYSADPRCS      240
241      LGFGSPGGALAPGKVPPELEVWYRRAGSLCPEITPSLLAAQGRQESGFRRGATSPAGAQG      300
301      LAQFLPGTAASASPIDGRPYVLDADGNGAASVWDDGDAIMGQGRYMCSLAAKIRQWQAEG      360
361      RVQGDVTALALAAYNAGEGAVLASGGMPNQYAAHYSETRPYVANILAMEPQYRAPGSLGR      420
421      FTPEEGERGPQILEAAHEWLGTPYVWGGGGPQGPSNGGMDGPGLTAAAVFAASGGEVMLP      480
481      RTAEQQWEFGEEVSMGKAQPGDLVFSDFGPRGPARVGVYAGEGRMIQSAPAGQDSRAGGV      540
541      SEIPVPGDARVRRVL                                                   555