Sequence for MER0055216

>MER0055216 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 90-259 ( active site residue(s): 235 metal ligand(s): 156,160,237 ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006362) 
1        MPHHRMTSGSLSVKELLGEVTDEPRARHRMAADSTDRFKGVAGVAVAAGALLGTMAQAAP       60
61       ATAATTDLRAGGISDADADSDAAVSAAAPASTPATAPFGLGGLPDELAAPLAQAEQIIKD      120
121      LQTASPSVTAPAAAPAVLPVGREISSGYGSRWGAFHYGVDIADALGTPIRSAMGGTVIEA      180
181      GPASGFGQWVRVQQDDGTIAVYGHINEYYVQAGDRVSAGDVIAAVGNRGQSTGPHLHLEI      240
241      WDQDSNKIDPVAWLEGNGVLTEQRWGID                                      268