Sequence for MER0055215

>MER0055215 - signal peptidase II [A08.001] peptidase unit: 75-151 ( active site residue(s): 118,141  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006619) 
1        MTATASSAPTVSRWGRRLRWAITAAVLAGLDLALKAWAQTALDGAPVEAGPVDLRLAFNP       60
61       GAAFSIAADAPSWVMLSITTVITTGVAVGGWVLAPRASLLTRVALAAILGGAAANVIDRA      120
121      PDGLVTDYLHTGWWPTFNLADSFIVLGAIALIITTLIGNSDEREQLSPDHHTDKRD          176