Sequence for MER0055213

>MER0055213 - family S15 unassigned peptidases [S15.UPW] peptidase unit: 163-413 ( active site residue(s): 215,352,381  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MRRAFRVTVAGLAAALFLPFLGSGATAAPLPTGPDGGAAGQAWAATHDGPQQFPNIHITW       60
61       DVPITMSDGTVLKANLYRPADVLGNPVPVATPTVVNMTPYTKLVSNLADHAGSVPGLSDA      120
121      MIGLFREIDMTGTPFSGVTDLTKAFGGGQLRNFAVDRSLVRSGYTQLVVDVRGTGFSQGE      180
181      WDMLRDREQQDTVEVIDWAARQPWSNGRIGMSGISYSAINQVQAAEKAPPALQAIFPIVP      240
241      GSDLVTDVLAPGGGFGFNFIPLWLTAINTLKWVPDVQSLVTGNFDQQWLTDRMDSPLTYM      300
301      DVFLNAYSKTRLEDLDPRVRSMLTDGSPERKAWLGDPSRITIPTFVVGGWHDLFTYSESQ      360
361      IYNQISAPPGHKQLLMGNTYHLNSGNEYAEPGLPPRLDVLQRAWFDRWLKDIDNGIDRYG      420
421      PVTLRQQGGGWITQNGFGDSAEGAEVAEHRRMYLSGAPSGTARSVYDGSLLAEQDGSTQR      480
481      LTVAPGLTGLCSNDAGQATAGVLAAIDACGADSRIQETNGLTFTSAPVAEPTVISGPIAV      540
541      RLNTVQDAADGYWSVTVNDVAPDGRSTVLSSGQLMASLRSIDESRSSRSANGDYTDPRPL      600
601      ASLEDRLPVIPGEPTTLDIALPATEAVLQPGHRLRVDVYAGNFPKGLPILPMLVDTGLKP      660
661      QHLQLDPQRPSFVNIPVRGNPGW                                           683