Sequence for MER0042821

>MER0042821 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 7-257 ( active site residue(s): 97,220,247  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLNTYRINGVEIGFDDQGYAPDRPAIVLLPGWGHDHRAFDRMLPHLRPHHRVIRVCWRGH       60
61       GIDRTLVGDFGVAEQVSDTIGLLDALEVERFVPLSHAHGGWAAMDIADTLGADRVPALLL      120
121      MDLIMTPPPPEFAAGLRALQDERTWRAAQRGLLDSWLAGSTDQAVLDHVRYEAGGHGFDM      180
181      WARSGRVIETAYATWGSPMGRLDKFTEPRPVRHVYSHPKSAEYDAVHAEFRRTHPWFSYT      240
241      RLDGHTHFPGIELPERVTTELFDLIGTQTPAT                                  272