Sequence for MER0042820

>MER0042820 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 58-331 ( active site residue(s): 136,279,308  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSDITAASGARWRPDVLGADYEQHTIELGADPDGEGDIAATLVRHVPGSASEATDCAVLY       60
61       VHGFTDYFFQRHLAEHFAARGHRFYALDLRKCGRSLRSGQSPHYVTDLAFYDAELDEALR      120
121      IVRAETGAPVLLVAHSTGGLIVPLWLDRRNRAGGTAAAGVIGLVLNSPWFDLQGPSYYRT      180
181      IGTPLIDALGRFRATSRLPGAGISTYGDSLHKSVAGEWDYNLDWKPLAGAPVRFGWLRAI      240
241      RRGHFRLHQGLDVGVPSLILRSRLTKFLRKYGPAADVADTVLDVKQIQRWSGCLGDRTNI      300
301      VPIDGARHDVFLSSEQPRAQAFAELDRWLDWLAEYRRAAASPETGA                    346