Sequence for MER0042813

>MER0042813 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 198-447 ( active site residue(s): 259,390,422  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MRVMRTGRLLVSLVAVLVAVAACSSGSEAPDQVSGAWHGVIEVPGQPLAVGIDVTGPDSA       60
61       TIDIPAQGIDGLALRDVRTAPGDVGFVLPGIPGEPTFKGALDREKDRITGDFTQFGQSVP      120
121      LTLEPGELAPPNRPQEPKPPLPYRAEEVTFRSGEITVAGTLTRPEGTGPFPAVVLITGSG      180
181      AQNRDEEIAGHKPFLLLADTLTRAGYAVLRTDDRGVGGTGGDLETSNYDDLADDAAAGIA      240
241      YLRGRPDIAPDRIGLLGHSEGGYLAPLVAARPDSGVAFAILMAGPAVPGGDALIEQTRAI      300
301      LAASGVPAEEIDKQVSDTTEMVGLLRAGDIEGARAVFQRRMAQLPPEMRESMTEADNPIT      360
361      PYYAAFVAYDPAPALAALRVPVFAFFGEKDLQVLPGQNEGPARQLLAAGPDATVRVFPGL      420
421      NHLMQPTATGAIDEYSTIETTIAPEVLTAVTEWLTDRVPPR                         461