Sequence for MER0042812

>MER0042812 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 25-373 ( active site residue(s): 127,314,341  ) (Nocardia farcinica) (Source: MEROPS) 
1        MATDESIDRGAATAAVQRRDVEFLSDGVPCAAWLYTTPGAPGPRPIVIMGHGLGAVREMR       60
61       LAAFAERFAANGWSVLVFDYRHLGASGGRPRQLLDIGRQLADWRAAVAFARTLPEVDVDR      120
121      IALWGTSFGGGHVLQVGSGNPQVAAIVAQCPFTDGPASLISRLRTGPLSAVALMAVGILD      180
181      TARSWLGSKPILVPMAGTSWMPAFVASPDAIAGASALLPPGTRLSRRSSALLRRLPSVRA      240
241      RLSENIELTIADDREPVTKVGRDSIWGVFRGPGNDFDAANALAARLVLRLPLYRPGRAMA      300
301      RSGVPTLLCVCDNDAAAPAETTKRRARGLAHVRVKTYPCDHFDIYLGTYFEDAVRDQIDF      360
361      LAEQFADTVPAAT                                                     373