Sequence for MER0042783

>MER0042783 - family M38 unassigned peptidases [M38.UPW] peptidase unit: 12-208 (Nocardia farcinica) (Source: MEROPS) 
1        MRTQLLIGGRFYSSSSPDATAMAVQDGTIVWLGAEQPGRALHPDAEIVDLDGAFVAPAFV       60
61       DPHVHVTALGLRLIGLDLTATGSLAECLAAVRAHAAEHPEAAVLGTGWDETRWPERRAPS      120
121      AEELDAAAGPGRRVYLARVDAHSAAVSSALLALVPAGTRGHTPGAPLRADAHHLVRAAAL      180
181      AGLDRAQRDRARRAALDAAAAHGIVAVHECAGPDIAGRDDLRELLDVEHGVEVRAYWGQA      240
241      VGSAAEATALLAEVGAHALGGDLFVDGSLGSRTALLRAPYADGPGTGVSYLDADAIGAHV      300
301      RACTEAGIQAGFHVIGDAGMDAVVAGFEQAVAALGGPAVAARGHRVEHAEMLDAAQIDAL      360
361      ARWGVIASVQPVFDATWGGPDGMYAARLGAERAAGLNPYAAMAAAGIALAIGSDAPVTEL      420
421      NPWAAVRAASLHRTPGHGISPRAAFAAATRGAWRAGGVRDGVAGTLVPGAPASYAIWEAG      480
481      ELVVAAAADSVQRWSTDPRSRVPGLPALEPDSPLPRCLRTVHRGVTIYQA                530