Sequence for MER0042781

>MER0042781 - family M38 unassigned peptidases [M38.UPW] peptidase unit: 26-371 (Nocardia farcinica) (Source: MEROPS) 
1        MPTTALTGIGQLVTNDPALGEGPLGLRRDAAIVFEDGVVAWVGDSAHVPATDTAHDLDGR       60
61       AVLPGFVESHSHLVFAGDRAEEFAARMSGRPYGAGGIRTTIEATRAATDEQLGANVRRLL      120
121      DESLRAGSTTVECKSGYGQSVEHELRSVRVAGRYTDEVTLLAAHVPPPEYAGRVDDYVAM      180
181      ACAEMIPRCAPHAKWIDVFCEQGAFDRDQAHAVLTAGIAHGLVPRVHGNQLHRGPGVQLA      240
241      VEVGAASVDHVTYIDDADIEALAHSDTVATLLPGADFCTRNSYPDARALLDAGVTVALGA      300
301      DCNPGTSYTTSLPFCIALAVRELRMTPDEAVWAATAGGARALRRGDVGVLTPGARADALA      360
361      LDAPSHLHLAYRPGVPLISRVWREGTLAYATN                                  392