Sequence for MER0042744

>MER0042744 - family M38 non-peptidase homologues [M38.UNW] peptidase unit: 26-189 ( metal ligand(s): 63,65 ) (Nocardia farcinica) (Source: MEROPS) 
1        MYDTIIKGGRWFDGTGAASAIRNLGIRDGRVATVSAAPLDEQGCARVIDATDRWVLPGMI       60
61       DIHTHYDVEVLGSPQLSESLRHGITTVLLGSCSISTVHVGPETAGDLFGRVEAIPRRHVI      120
121      DAVARGKSWSSAHEYAQALEELPLGPNVAAFIGHSDMRAAAMGLDRATRAGVRPDGAELD      180
181      TMARWLTEALDAGFVGMSSQQLRFDKLDGQYCRSRTLPSTFATARERRRLGDILRARGRV      240
241      LQGGPDASRPHTVVTMAAATLGLFRAPLKVSLLSAADLKALPAVIHLFSLLARTLNLLGG      300
301      NFRWQHLPVPFEVYADGIDLVIFEEFGAGAAAMHLADQVERRRDMLADPDYRRRFRRDYD      360
361      RRFGPRVWHRDFFDAEIVDCPDPRVIGKTFGQVGLDRGGLHPVDAFLDLVVEHGDKVRWR      420
421      TTISNHRPHVLDRLAAHPGVHLGFSDAGAHLRNMAFYNFGLRFLRRVHEAERAGRPFLSL      480
481      ERAVHRMTGELADWYGLDAGHLRQGDRADVVVIDPAHLDAELDRYAEAPVAQYDNLSRMV      540
541      NRNDAAVTAVLVGGEFVFGEGRAGDSVGVTRTGRFLRAR                           579