Sequence for MER0042717

>MER0042717 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-361 ( active site residue(s): 141,299,329  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSLADTLTLAARNAWALTFGPGVEAPEPTRSTVLWDAAHRELRRFERDEARDGAAAEGAD       60
61       PVLLVPPLAAPASCFDLRPDQSLARFLLGTGRTPYVVDYGEITFADRRMGFEDWINDILP      120
121      EAVLRTSADRDGAAVDLVGWSLGGTLALLTAAAHPQLPIGSITAVGSPLDYDRMTGMPQV      180
181      RAVAKLDGGLAVSTAVRAAGGIPAPLTRAAYRVTAWNRELTRPLFVASNIARTEALAKME      240
241      SIDRFMAQMPGYPGRFYGQLWGRLILNNDIGRGVLRLGGREIALAAVTAPVLLVGGPADV      300
301      ITPAPAVEAGTRTLTGAAFVRYETAPGSHLGILTGETARETTWTYLDEFLTEAAAVRESV      360
361      S                                                                 361