Sequence for MER0042716

>MER0042716 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-234 ( active site residue(s): 77,191,211  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSTFVLVHGSWAGGWHWADIRARLEQAGHRVHAPSLTGMADRHHLAGEHVGLHTHIDDVA       60
61       RLLEWERLTDVILVGHSYGGMVITGAAARVPERIAHVVYLDAFLPRAGEAAWDLLPWQRE      120
121      AFQQLRLPDRPWLVRPVDAAAFFPELGEDFDDNRPTPMPIATHEQPVPDAPAPGALPGTY      180
181      IHCTAAPAYFDDVARRAADDGLAVVTLDAGHMALLTHADEVSATLLELAQEAPR            234