Sequence for MER0042667

>MER0042667 - family S15 unassigned peptidases [S15.UPW] peptidase unit: 56-533 ( active site residue(s): 123,244,270  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRIVEKFPYEVLDTENVFIPMRDGARLAARIWRPVTDEPVPAVFEYIPYRKRDLTRARDA       60
61       LNHPYLAGHGYVSVRVDLRGSGDSDGVLTDEYLPTEHDDACDVIAWLADQPWCDGNVGMM      120
121      GISWGGFNSLQVAARRPPALKAIVSASATEDLYVDNMHYMGGCLLSDNLSEATVMFAFNS      180
181      LPPDPAIVGDRWRDMWRERLAGSGLWIEQWLEHQHRDEYWKRASVNEDYRAVDCPVLAVG      240
241      GWADGYTNAIFRLLEHLDVPRRGLIGPWGHKYPHLGVPGPAIGFLQELVRWWDHWLKGRD      300
301      TGVMDEPMLRAWMQDSISPQPSYADRPGRWVGEPSWPSPNIVPREFTLTRYGLAEDAGDV      360
361      PARTMRVQSPLSVGMFAGKWASYAATPDLPSDQREEDGGSLVYETEELTETFEVLGQPEL      420
421      ALTVAADRPNAMVAARLSDVAPNGEATRVTYGLLNLTHRDGSGEPRPLEPGRTYRVRLAL      480
481      NGMAHSFPPGHRIRLSISSSYWPLAWPSPEPVMLTVTTGESLLTLPQRPRRAEDERLRPF      540
541      DDPEAAPPAPATNIERGTHHWKVERDLATGVSTLEIENDQGLIRLDDTGTLVRRATTEWF      600
601      SFRGNDPTSVRGETRTVRAFARDNWRTEITTHTVLRCTPQDFVLDARLDAYELGDPADDP      660
661      RPVATRVYSQNWHRRIPRDLV                                             681