Sequence for MER0042645

>MER0042645 - subfamily M20D non-peptidase homologues [M20.UND] peptidase unit: 3-267 ( active site residue(s): 16 metal ligand(s): 17,239 ) (Nocardia farcinica) (Source: MEROPS) 
1        MPELPVGVRLIFQPAEEVMPGGALDMVAAGALDGIERIFAVHCDPRLEVGRVGMRVGAIT       60
61       SAADTVELVLDSPGGHTSRPHLTSDLVYAIGTVITGLPGLLSRRIDPRTSTVMVWGAVSA      120
121      GKAPNAIPQTGMLTGTVRTGDHATWSLLEPMVHEIVDGLLAPTGVRYQLNYRRGVPPVVN      180
181      DEHSARQFEDAIRALGPDALSDTPQSGGGEDFSWYLEEVPGAMARLGVWSGHGEQLDLHQ      240
241      PTFDIDERALAVGVRVFTNLVLQQRPR                                       267