Sequence for MER0042640

>MER0042640 - subfamily M20D non-peptidase homologues [M20.UND] peptidase unit: 22-395 ( active site residue(s): 147 metal ligand(s): 112,114,148,172,361 ) (Nocardia farcinica) (Source: MEROPS) 
1        MPPPPPVPPSRDGARADAGARVDAAARADAAIGAAGPRLIALSHAIHAEPELAFAEHRSV       60
61       AKTLEPLAERGFEITTGVAELPTAFRAVYGSGSLTVGLCAEYDALPEIGHACGHNIIAAA      120
121      SVGAGLGLAEVADALDLTVVVLGTPAEESGGGKVLMLERGVFDDIAMAMMVHPGPCDIAG      180
181      ARSLALADIAVRFHGREAHASAAPDQGRNAGDAVTVAQVALGLLRQHLKPGQQLHGIVSD      240
241      GGIAPNIVPGHAELLYYLRAADSASLDDLMRRASACFEAGALATGCTHEIRTLAPTYTEL      300
301      TPDPGLLRVYREQIADLGRVPIAADLEAARPLGSTDMGNVTNVVPGIHPVIGIDAGGAVT      360
361      HQPGFAAASVNASADRAVIDGARALARTAIAVARDEEHRGRLWQRLVRRQEDIR            414