Sequence for MER0042635

>MER0042635 - family M20 unassigned peptidases [M20.UPW] peptidase unit: 13-408 ( active site residue(s): 81,124 metal ligand(s): 79,90,125,198,379 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTFDALWDSIRAIGRHPGTGGYRRFAWTDADLTLREWFTGCATQRGMDVEQDRNGNLWAW       60
61       WLPPGHTGEPRDAFVTGSHLDSVPDGGAYDGPLGVVSAFAAVDLLRERGTVPARPVAVTA      120
121      FSDEEGARFGVACVGSQLSTGALAPARALGLRDADGITLAEALTAAGREPRHLGPDPALT      180
181      ERVGVFVELHVEQGRALDLVDRPVAVASSIWPHGRWLFRFTGEANHAGATRLADRHDPML      240
241      AFAASVHSARQAAQLHDAVATFGKLRVLPNGANAIPSEVLAWLDARAADEITLDALVTHI      300
301      AEAARKHAEADGVTVDLETESLTPIVEFPAGPRARITRALSRLGEIPVLPTAAGHDAGIL      360
361      SARVPTAMLFVRNPTGISHSPAEYATPEDCRTGARALADVMGEWVAAG                  408