Sequence for MER0042627

>MER0042627 - acetylornithine deacetylase ArgE [M20.974] peptidase unit: 1-452 ( active site residue(s): 95,159 metal ligand(s): 93,125,160,187,427 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSATGEVTGPNNSRAVAEVVELVSRLIRFDTSNTGDLATTKGEQECAEWVGEKLREVGYT       60
61       TEYVESGAPGRGNIFARLPGADPGRGALMMHGHLDVVPAQASDWSVHPFSGAVRDGYVWG      120
121      RGAIDMKDMVGMMLAVARQFKAEGTVPPRDIVFAFLADEENGGRWGSQWLVDNRPDLFAG      180
181      VTEAVGEVGGFSLTVPRRDGGERRLYLVETAEKGLGWMRLRAKARAGHGSFLHEDNAVTI      240
241      LAQAVARLGTHTFPLVLSDSVAEFLAVVAEETGLPFDPTGPDIEGQLAKLGTISRIIGAT      300
301      LRDTANPTMLQAGYKANVIPQTAEAVVDCRVVPGRQAAFEREVDELIGPDVEREWITKLD      360
361      SYETTFDGHLVDAMNEAILAHDPEGRTVPYMLSGGTDAKAFARLGIRCFGFAPLRLPPDL      420
421      DFSALFHGVDERVPVDALEFGTRVLEHFLLHS                                  452