Sequence for MER0042558

>MER0042558 - family T5 unassigned peptidases [T05.UPW] peptidase unit: 201-405 ( active site residue(s): 201  ) (Nocardia farcinica) (Source: UniProt Q5YYF8) 
1        MTTTDSGTGKLVRTQGVTAPLGFRAAGIAAGIKASGKPDLALVFNEGPEYAAAGVFTRNK       60
61       VKAAPVLWSQQVLTSRRLRAVILNSGGANACTGPEGFQDTHRTAEELARALSNWGTETGA      120
121      GEIAVCSTGLIGDRLPMDKLIPAVTEIVHEMGGGLSGGTDAAHAIMTTDTVPKEAAFHHR      180
181      DKWNVGGMAKGAGMLAPSLATMLVVLTTDAAVTAEQLDTALRKATRLTFDRLDVDGSCST      240
241      NDTVLLLANGASEVTPSQEELEAAVFAVCDDLAAQLMADAEGVTKRVRVTVTGAANEDEA      300
301      VTAARAIARDSLVKTALFGSDPNWGRVLAAVGIAPITLDPDRISVSFNGNPVCVNGVGAP      360
361      GARQVDLSGADIDVLVELNVGDGEAMIRTTDLSHGYVEENSAYSS                     405