Sequence for MER0042507

>MER0042507 - pantetheinyl hydrolase ThnT precursor [P01.101] peptidase unit: 246-352 ( active site residue(s): 246  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTAVPGPRDALTDVAGLLVGHHHVLDADASLGAGAATGCTVVRAPGGVTAAVDVRGGGPG       60
61       TRETDLLDPANTVRQVHALLLTGGSAYGLAAADGVMRWLEEHGEGIPMDPAEPARVVPIV      120
121      PGAVIFDLPVGAWDIRPTAEFGRLAAQAAGTEFARGSVGAGTGARAGSIKGGVGTASVVL      180
181      GDGPAAGVTVAALVVANPVGSVFDPRTGLPWGVGTDGPERFGLRPPTPEQLAAANALPVK      240
241      GTVLNTTIGVVATDAALDPAGCRRMATTAHDGLARAIRPAHSPLDGDTLFGVATGAVQPP      300
301      GFPLPSAFPAELLVLDAVCTAAAVCVERAVVDAVLTATTVAGVPAYRDLFPS              352