Sequence for MER0042484

>MER0042484 - family M56 unassigned peptidases [M56.UPW] peptidase unit: 136-268 ( active site residue(s): 183 metal ligand(s): 182,186,223 ) (Nocardia farcinica) (Source: MEROPS) 
1        MNATAPVFAGLALLLAGPAPALLSRAKWPYRTPRAALVLWQAIALAAVLSAFGSGLAIAA       60
61       ELLVPGPDGRPTTSPTREIDALGFPLWLAYVVVFALTLLVGARLIFSIVRVGVHTRRRRA      120
121      KHRMLVDLLDQSGPRRRAHDIRVLAATEPIAYCLPGLRQRVVLSEGTLTNLADPEVTAIV      180
181      SHERSHLRARHDLVLEAFTAVHEAFPRVVRSKAALGSVKLLIELLADDSAVKVTGPAPLA      240
241      RALVACAKSTAPQGALAAGGPTTLIRVQRLGQGGSGDVRIATAAYLGSIAILVVPTLAVA      300
301      VPWLVELSRLFNS                                                     313