Sequence for MER0042464

>MER0042464 - subfamily M50B unassigned peptidases [M50.UPB] peptidase unit: 23-262 ( active site residue(s): 66 metal ligand(s): 65,69,192 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSLPFSRDRRLGRGAVRPSPVFLLVVAVTVAGAVLAWISDYGETAAGVGVFVLVVAGWIV       60
61       TLCLHEFAHAYLAWRAGDREVELRGYLTLNPLKYSHPLLSIVLPVVFIALGGFGLPGGAV      120
121      YVHPHAVSPARQRMISGAGPAVNAVCGVVLLLVVAVFGSTTGHAAFWYGLAFLGFLQITA      180
181      TLLNLLPIPGLDGYGILEPSLSYRTRRSLDQLKPLGMLLLFALILTPTVNRPFFDAIYTI      240
241      CELFGVPDVWVARGAGLVRFWT                                            262