Sequence for MER0042463

>MER0042463 - protein Rv2869c ({Mycobacterium tuberculosis})-type peptidase [M50.005] peptidase unit: 1-399 ( active site residue(s): 22 metal ligand(s): 21,25,335 ) (Nocardia farcinica) (Source: MEROPS) 
1        MVFAVGFVLFALGILISVALHECGHMWAAQATGMRVRRYFIGFGPTLWSFRRGETEYGLK       60
61       AIPLGGFCDIAGMTALDEVRPEELDRAMYRQATWKRLVVMVGGIVMNFLLGFLLIVVLAI      120
121      GWGLPNLDEPAPVVGQMQCVADQNPDRSQQQCTGAGPAEQGGLRPGDRVTAVNGVAVSTW      180
181      AEFTEQTRKQQGPIAYTVDRGGQTVQVTVTPQRVLRYATDGSSAQVSAIGITLDAPPAVI      240
241      EYSPVSAIPASVAFTGDLFVRTFEALAQMPAKVAALWEAVTGGERDPETPVSIYGASRIG      300
301      GESVEAGLWEVFVLLLASLNFFLGAFNILPLLPLDGGHIAVVLYEKVRNTVRGWRGLAPG      360
361      GPVDYLKLLPLTYAMVAIGGAYMVLTLAADIVNPIRLAP                           399