Sequence for MER0042363

>MER0042363 - HtpX-2 peptidase [M48.004] peptidase unit: 75-292 ( active site residue(s): 137 metal ligand(s): 136,140,209 ) (Nocardia farcinica) (Source: UniProt Q5YPB8) 
1        MHGRGYANGLKTFGLMVGLSALIVFAGAMFRNTTILVVAILLAVGMNAWAYFNSDRIALR       60
61       AMHALPVSELEAPVMYRIVRELATAARQPMPRLYISPTNAPNAFATGRNPRHAAVCCTSG      120
121      ILQILDERELRAVLGHELSHVYNRDILISSIAGALAAVVSGLANLAFFAGAFGGRGNGEG      180
181      PSMLGVLLVSLLGPIAATLVKLAVSRSREYEADRSGAELTGDPLALASALRKLERGTQAA      240
241      PLPPEPQLTAQSHLMIANPFRAGERAARLFSTHPPMAERIARLEEMAGGRSGGYR           295